Brand: | Abnova |
Reference: | H00005133-A01 |
Product name: | PDCD1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDCD1. |
Gene id: | 5133 |
Gene name: | PDCD1 |
Gene alias: | CD279|PD1|SLEB2|hPD-1|hPD-l |
Gene description: | programmed cell death 1 |
Genbank accession: | NM_005018 |
Immunogen: | PDCD1 (NP_005009, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSV |
Protein accession: | NP_005009 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |