PCYT1A monoclonal antibody (M03), clone 7H8 View larger

PCYT1A monoclonal antibody (M03), clone 7H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCYT1A monoclonal antibody (M03), clone 7H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PCYT1A monoclonal antibody (M03), clone 7H8

Brand: Abnova
Reference: H00005130-M03
Product name: PCYT1A monoclonal antibody (M03), clone 7H8
Product description: Mouse monoclonal antibody raised against a partial recombinant PCYT1A.
Clone: 7H8
Isotype: IgG2a Kappa
Gene id: 5130
Gene name: PCYT1A
Gene alias: CT|CTPCT|PCYT1
Gene description: phosphate cytidylyltransferase 1, choline, alpha
Genbank accession: NM_005017
Immunogen: PCYT1A (NP_005008, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS
Protein accession: NP_005008
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005130-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00005130-M03-1-9-1.jpg
Application image note: PCYT1A monoclonal antibody (M03), clone 7H8 Western Blot analysis of PCYT1A expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCYT1A monoclonal antibody (M03), clone 7H8 now

Add to cart