Brand: | Abnova |
Reference: | H00005130-M02 |
Product name: | PCYT1A monoclonal antibody (M02), clone 6E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCYT1A. |
Clone: | 6E6 |
Isotype: | IgG2a Kappa |
Gene id: | 5130 |
Gene name: | PCYT1A |
Gene alias: | CT|CTPCT|PCYT1 |
Gene description: | phosphate cytidylyltransferase 1, choline, alpha |
Genbank accession: | NM_005017 |
Immunogen: | PCYT1A (NP_005008, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS |
Protein accession: | NP_005008 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | PCYT1A monoclonal antibody (M02), clone 6E6. Western Blot analysis of PCYT1A expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |