PCTK1 monoclonal antibody (M02), clone 2E5 View larger

PCTK1 monoclonal antibody (M02), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCTK1 monoclonal antibody (M02), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,IP

More info about PCTK1 monoclonal antibody (M02), clone 2E5

Brand: Abnova
Reference: H00005127-M02
Product name: PCTK1 monoclonal antibody (M02), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant PCTK1.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 5127
Gene name: PCTK1
Gene alias: FLJ16665|PCTAIRE|PCTAIRE1|PCTGAIRE
Gene description: PCTAIRE protein kinase 1
Genbank accession: BC001048
Immunogen: PCTK1 (AAH01048, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDG
Protein accession: AAH01048
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005127-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005127-M02-31-15-1.jpg
Application image note: Immunoprecipitation of PCTK1 transfected lysate using anti-PCTK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PCTK1 MaxPab rabbit polyclonal antibody.
Applications: IF,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy PCTK1 monoclonal antibody (M02), clone 2E5 now

Add to cart