PCSK2 monoclonal antibody (M01), clone 3H4 View larger

PCSK2 monoclonal antibody (M01), clone 3H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCSK2 monoclonal antibody (M01), clone 3H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCSK2 monoclonal antibody (M01), clone 3H4

Brand: Abnova
Reference: H00005126-M01
Product name: PCSK2 monoclonal antibody (M01), clone 3H4
Product description: Mouse monoclonal antibody raised against a partial recombinant PCSK2.
Clone: 3H4
Isotype: IgG2a Kappa
Gene id: 5126
Gene name: PCSK2
Gene alias: NEC2|PC2|SPC2
Gene description: proprotein convertase subtilisin/kexin type 2
Genbank accession: NM_002594
Immunogen: PCSK2 (NP_002585.2, 501 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQS
Protein accession: NP_002585.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005126-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005126-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PCSK2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCSK2 monoclonal antibody (M01), clone 3H4 now

Add to cart