PCSK1 monoclonal antibody (M01), clone 2G12 View larger

PCSK1 monoclonal antibody (M01), clone 2G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCSK1 monoclonal antibody (M01), clone 2G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCSK1 monoclonal antibody (M01), clone 2G12

Brand: Abnova
Reference: H00005122-M01
Product name: PCSK1 monoclonal antibody (M01), clone 2G12
Product description: Mouse monoclonal antibody raised against a partial recombinant PCSK1.
Clone: 2G12
Isotype: IgG1 Kappa
Gene id: 5122
Gene name: PCSK1
Gene alias: BMIQ12|NEC1|PC1|PC3|SPC3
Gene description: proprotein convertase subtilisin/kexin type 1
Genbank accession: NM_000439
Immunogen: PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Protein accession: NP_000430
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005122-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005122-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PCSK1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCSK1 monoclonal antibody (M01), clone 2G12 now

Add to cart