PCP4 monoclonal antibody (M14), clone 1E3 View larger

PCP4 monoclonal antibody (M14), clone 1E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCP4 monoclonal antibody (M14), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCP4 monoclonal antibody (M14), clone 1E3

Brand: Abnova
Reference: H00005121-M14
Product name: PCP4 monoclonal antibody (M14), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant PCP4.
Clone: 1E3
Isotype: IgG2a Kappa
Gene id: 5121
Gene name: PCP4
Gene alias: PEP-19
Gene description: Purkinje cell protein 4
Genbank accession: NM_006198
Immunogen: PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Protein accession: NP_006189.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005121-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005121-M14-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PCP4 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCP4 monoclonal antibody (M14), clone 1E3 now

Add to cart