PCNA monoclonal antibody (M10), clone 2E9 View larger

PCNA monoclonal antibody (M10), clone 2E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCNA monoclonal antibody (M10), clone 2E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,PLA-Ce

More info about PCNA monoclonal antibody (M10), clone 2E9

Brand: Abnova
Reference: H00005111-M10
Product name: PCNA monoclonal antibody (M10), clone 2E9
Product description: Mouse monoclonal antibody raised against a full length recombinant PCNA.
Clone: 2E9
Isotype: IgG2a Kappa
Gene id: 5111
Gene name: PCNA
Gene alias: MGC8367
Gene description: proliferating cell nuclear antigen
Genbank accession: NM_002592
Immunogen: PCNA (NP_002583, 78 a.a. ~ 177 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGN
Protein accession: NP_002583
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005111-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005111-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PCNA is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy PCNA monoclonal antibody (M10), clone 2E9 now

Add to cart