PCNA monoclonal antibody (M04), clone S1 View larger

PCNA monoclonal antibody (M04), clone S1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCNA monoclonal antibody (M04), clone S1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PCNA monoclonal antibody (M04), clone S1

Brand: Abnova
Reference: H00005111-M04
Product name: PCNA monoclonal antibody (M04), clone S1
Product description: Mouse monoclonal antibody raised against a full length recombinant PCNA.
Clone: S1
Isotype: IgG2b Kappa
Gene id: 5111
Gene name: PCNA
Gene alias: MGC8367
Gene description: proliferating cell nuclear antigen
Genbank accession: BC000491
Immunogen: PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Protein accession: AAH00491
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005111-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (54.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00005111-M04-1-25-1.jpg
Application image note: PCNA monoclonal antibody (M04), clone S1 Western Blot analysis of PCNA expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.Hsieh MY, Fan JR, Chang HW, Chen HC, Shen TL, Teng SC, Yeh YH, Li TK
Clin Cancer Res. 2014 Mar 15;20(6):1489-501. doi: 10.1158/1078-0432.CCR-13-1997. Epub 2014 Feb 13.

Reviews

Buy PCNA monoclonal antibody (M04), clone S1 now

Add to cart