PCMT1 monoclonal antibody (M02), clone 1D6 View larger

PCMT1 monoclonal antibody (M02), clone 1D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCMT1 monoclonal antibody (M02), clone 1D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PCMT1 monoclonal antibody (M02), clone 1D6

Brand: Abnova
Reference: H00005110-M02
Product name: PCMT1 monoclonal antibody (M02), clone 1D6
Product description: Mouse monoclonal antibody raised against a partial recombinant PCMT1.
Clone: 1D6
Isotype: IgG1 Kappa
Gene id: 5110
Gene name: PCMT1
Gene alias: -
Gene description: protein-L-isoaspartate (D-aspartate) O-methyltransferase
Genbank accession: NM_005389
Immunogen: PCMT1 (NP_005380, 117 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
Protein accession: NP_005380
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005110-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00005110-M02-1-1-1.jpg
Application image note: PCMT1 monoclonal antibody (M02), clone 1D6 Western Blot analysis of PCMT1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCMT1 monoclonal antibody (M02), clone 1D6 now

Add to cart