PCMT1 monoclonal antibody (M01), clone 4G9 View larger

PCMT1 monoclonal antibody (M01), clone 4G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCMT1 monoclonal antibody (M01), clone 4G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PCMT1 monoclonal antibody (M01), clone 4G9

Brand: Abnova
Reference: H00005110-M01
Product name: PCMT1 monoclonal antibody (M01), clone 4G9
Product description: Mouse monoclonal antibody raised against a full length recombinant PCMT1.
Clone: 4G9
Isotype: IgG2a Kappa
Gene id: 5110
Gene name: PCMT1
Gene alias: -
Gene description: protein-L-isoaspartate (D-aspartate) O-methyltransferase
Genbank accession: BC007501
Immunogen: PCMT1 (AAH07501.1, 1 a.a. ~ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL
Protein accession: AAH07501.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005110-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.82 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00005110-M01-1-11-1.jpg
Application image note: PCMT1 monoclonal antibody (M01), clone 4G9 Western Blot analysis of PCMT1 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCMT1 monoclonal antibody (M01), clone 4G9 now

Add to cart