Brand: | Abnova |
Reference: | H00005100-M01 |
Product name: | PCDH8 monoclonal antibody (M01), clone 6A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH8. |
Clone: | 6A8 |
Isotype: | IgG1 Kappa |
Gene id: | 5100 |
Gene name: | PCDH8 |
Gene alias: | ARCADLIN|PAPC |
Gene description: | protocadherin 8 |
Genbank accession: | NM_002590 |
Immunogen: | PCDH8 (NP_002581, 32 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH |
Protein accession: | NP_002581 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Identification of Cell Surface Targets through Meta-analysis of Microarray Data.Haeberle H, Dudley JT, Liu JT, Butte AJ, Contag CH. Neoplasia (2012) 14, 666-669 |