PCDH8 monoclonal antibody (M01), clone 6A8 View larger

PCDH8 monoclonal antibody (M01), clone 6A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDH8 monoclonal antibody (M01), clone 6A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PCDH8 monoclonal antibody (M01), clone 6A8

Brand: Abnova
Reference: H00005100-M01
Product name: PCDH8 monoclonal antibody (M01), clone 6A8
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDH8.
Clone: 6A8
Isotype: IgG1 Kappa
Gene id: 5100
Gene name: PCDH8
Gene alias: ARCADLIN|PAPC
Gene description: protocadherin 8
Genbank accession: NM_002590
Immunogen: PCDH8 (NP_002581, 32 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
Protein accession: NP_002581
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005100-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005100-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Identification of Cell Surface Targets through Meta-analysis of Microarray Data.Haeberle H, Dudley JT, Liu JT, Butte AJ, Contag CH.
Neoplasia (2012) 14, 666-669

Reviews

Buy PCDH8 monoclonal antibody (M01), clone 6A8 now

Add to cart