PCDHGC3 monoclonal antibody (M05A), clone 1E7 View larger

PCDHGC3 monoclonal antibody (M05A), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHGC3 monoclonal antibody (M05A), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PCDHGC3 monoclonal antibody (M05A), clone 1E7

Brand: Abnova
Reference: H00005098-M05A
Product name: PCDHGC3 monoclonal antibody (M05A), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHGC3.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 5098
Gene name: PCDHGC3
Gene alias: PC43|PCDH-GAMMA-C3|PCDH2
Gene description: protocadherin gamma subfamily C, 3
Genbank accession: NM_002588
Immunogen: PCDHGC3 (NP_002579, 71 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNE
Protein accession: NP_002579
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005098-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHGC3 monoclonal antibody (M05A), clone 1E7 now

Add to cart