PCDH1 monoclonal antibody (M01), clone 5D5 View larger

PCDH1 monoclonal antibody (M01), clone 5D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDH1 monoclonal antibody (M01), clone 5D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about PCDH1 monoclonal antibody (M01), clone 5D5

Brand: Abnova
Reference: H00005097-M01
Product name: PCDH1 monoclonal antibody (M01), clone 5D5
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDH1.
Clone: 5D5
Isotype: IgG1 Kappa
Gene id: 5097
Gene name: PCDH1
Gene alias: FLJ53887|MGC45991|PC42|PCDH42
Gene description: protocadherin 1
Genbank accession: NM_002587
Immunogen: PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
Protein accession: NP_002578
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005097-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005097-M01-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PCDH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Identification of PCDH1 as a Novel Susceptibility Gene for Bronchial Hyperresponsiveness.Koppelman GH, Meyers DA, Howard TD, Zheng SL, Hawkins GA, Ampleford EJ, Xu J, Koning H, Bruinenberg M, Nolte IM, van Diemen CC, Boezen HM, Timens W, Whittaker PA, Stine OC, Barton SJ, Holloway JW, Holgate ST, Graves PE, Martinez FD, van Oosterhout A, Blee
Am J Respir Crit Care Med. 2009 Sep 3. [Epub ahead of print]

Reviews

Buy PCDH1 monoclonal antibody (M01), clone 5D5 now

Add to cart