PCBD1 monoclonal antibody (M01), clone 1G11-H5 View larger

PCBD1 monoclonal antibody (M01), clone 1G11-H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCBD1 monoclonal antibody (M01), clone 1G11-H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PCBD1 monoclonal antibody (M01), clone 1G11-H5

Brand: Abnova
Reference: H00005092-M01
Product name: PCBD1 monoclonal antibody (M01), clone 1G11-H5
Product description: Mouse monoclonal antibody raised against a full length recombinant PCBD1.
Clone: 1G11-H5
Isotype: IgG1 kappa
Gene id: 5092
Gene name: PCBD1
Gene alias: DCOH|PCBD|PCD|PHS
Gene description: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
Genbank accession: BC006324
Immunogen: PCBD1 (AAH06324, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Protein accession: AAH06324
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005092-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005092-M01-1-17-1.jpg
Application image note: PCBD1 monoclonal antibody (M01), clone 1G11-H5 Western Blot analysis of PCBD1 expression in C32 ( Cat # L002V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCBD1 monoclonal antibody (M01), clone 1G11-H5 now

Add to cart