Brand: | Abnova |
Reference: | H00005092-M01 |
Product name: | PCBD1 monoclonal antibody (M01), clone 1G11-H5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PCBD1. |
Clone: | 1G11-H5 |
Isotype: | IgG1 kappa |
Gene id: | 5092 |
Gene name: | PCBD1 |
Gene alias: | DCOH|PCBD|PCD|PHS |
Gene description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha |
Genbank accession: | BC006324 |
Immunogen: | PCBD1 (AAH06324, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
Protein accession: | AAH06324 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PCBD1 monoclonal antibody (M01), clone 1G11-H5 Western Blot analysis of PCBD1 expression in C32 ( Cat # L002V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |