PBX3 monoclonal antibody (M03), clone 2E12 View larger

PBX3 monoclonal antibody (M03), clone 2E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PBX3 monoclonal antibody (M03), clone 2E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PBX3 monoclonal antibody (M03), clone 2E12

Brand: Abnova
Reference: H00005090-M03
Product name: PBX3 monoclonal antibody (M03), clone 2E12
Product description: Mouse monoclonal antibody raised against a partial recombinant PBX3.
Clone: 2E12
Isotype: IgG2a Kappa
Gene id: 5090
Gene name: PBX3
Gene alias: -
Gene description: pre-B-cell leukemia homeobox 3
Genbank accession: NM_006195
Immunogen: PBX3 (NP_006186, 342 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN
Protein accession: NP_006186
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005090-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005090-M03-1-25-1.jpg
Application image note: PBX3 monoclonal antibody (M03), clone 2E12 Western Blot analysis of PBX3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PBX3 monoclonal antibody (M03), clone 2E12 now

Add to cart