Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PBX3 monoclonal antibody (M01), clone 1A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about PBX3 monoclonal antibody (M01), clone 1A9
| Brand: | Abnova |
| Reference: | H00005090-M01 |
| Product name: | PBX3 monoclonal antibody (M01), clone 1A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PBX3. |
| Clone: | 1A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5090 |
| Gene name: | PBX3 |
| Gene alias: | - |
| Gene description: | pre-B-cell leukemia homeobox 3 |
| Genbank accession: | NM_006195 |
| Immunogen: | PBX3 (NP_006186, 342 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN |
| Protein accession: | NP_006186 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | PBX3 is a putative biomarker of aggressive prostate cancer.Ramberg H, Grytli HH, Nygard S, Wang W, Ogren O, Zhao S, Lovf M, Katz B, Skotheim RI, Bjartell A, Eri LM, Berge V, Svindland A, Tasken KA. Int J Cancer. 2016 Oct 15;139(8):1810-20. Epub 2016 Jun 25. |