Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PBX1 monoclonal antibody (M04), clone 2D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PBX1 monoclonal antibody (M04), clone 2D6
| Brand: | Abnova |
| Reference: | H00005087-M04 |
| Product name: | PBX1 monoclonal antibody (M04), clone 2D6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PBX1. |
| Clone: | 2D6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5087 |
| Gene name: | PBX1 |
| Gene alias: | DKFZp686B09108|MGC126627 |
| Gene description: | pre-B-cell leukemia homeobox 1 |
| Genbank accession: | NM_002585 |
| Immunogen: | PBX1 (NP_002576, 311 a.a. ~ 403 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANG |
| Protein accession: | NP_002576 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |