PAX7 monoclonal antibody (M15), clone 4F5 View larger

PAX7 monoclonal antibody (M15), clone 4F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX7 monoclonal antibody (M15), clone 4F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PAX7 monoclonal antibody (M15), clone 4F5

Brand: Abnova
Reference: H00005081-M15
Product name: PAX7 monoclonal antibody (M15), clone 4F5
Product description: Mouse monoclonal antibody raised against a full length recombinant PAX7.
Clone: 4F5
Isotype: IgG2b Kappa
Gene id: 5081
Gene name: PAX7
Gene alias: HUP1|PAX7B
Gene description: paired box 7
Genbank accession: NM_002584
Immunogen: PAX7 (NP_001128726.1, 351 a.a. ~ 434 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGD
Protein accession: NP_001128726.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005081-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PAX7 monoclonal antibody (M15), clone 4F5 now

Add to cart