PAX7 monoclonal antibody (M09), clone 4F8 View larger

PAX7 monoclonal antibody (M09), clone 4F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX7 monoclonal antibody (M09), clone 4F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PAX7 monoclonal antibody (M09), clone 4F8

Brand: Abnova
Reference: H00005081-M09
Product name: PAX7 monoclonal antibody (M09), clone 4F8
Product description: Mouse monoclonal antibody raised against a partial recombinant PAX7.
Clone: 4F8
Isotype: IgG2a Kappa
Gene id: 5081
Gene name: PAX7
Gene alias: HUP1|PAX7B
Gene description: paired box 7
Genbank accession: NM_002584
Immunogen: PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Protein accession: NP_002575.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005081-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005081-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PAX7 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PAX7 monoclonal antibody (M09), clone 4F8 now

Add to cart