PAX7 monoclonal antibody (M05), clone 1E12 View larger

PAX7 monoclonal antibody (M05), clone 1E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX7 monoclonal antibody (M05), clone 1E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about PAX7 monoclonal antibody (M05), clone 1E12

Brand: Abnova
Reference: H00005081-M05
Product name: PAX7 monoclonal antibody (M05), clone 1E12
Product description: Mouse monoclonal antibody raised against a partial recombinant PAX7.
Clone: 1E12
Isotype: IgG2a Kappa
Gene id: 5081
Gene name: PAX7
Gene alias: HUP1|PAX7B
Gene description: paired box 7
Genbank accession: NM_002584
Immunogen: PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Protein accession: NP_002575.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005081-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00005081-M05-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PAX7 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PAX7 monoclonal antibody (M05), clone 1E12 now

Add to cart