PAX7 monoclonal antibody (M03), clone 3C9 View larger

PAX7 monoclonal antibody (M03), clone 3C9

H00005081-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX7 monoclonal antibody (M03), clone 3C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PAX7 monoclonal antibody (M03), clone 3C9

Brand: Abnova
Reference: H00005081-M03
Product name: PAX7 monoclonal antibody (M03), clone 3C9
Product description: Mouse monoclonal antibody raised against a partial recombinant PAX7.
Clone: 3C9
Isotype: IgG2a Kappa
Gene id: 5081
Gene name: PAX7
Gene alias: HUP1|PAX7B
Gene description: paired box 7
Genbank accession: NM_002584
Immunogen: PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Protein accession: NP_002575.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005081-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00005081-M03-1-1-1.jpg
Application image note: PAX7 monoclonal antibody (M03), clone 3C9 Western Blot analysis of PAX7 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PAX7 monoclonal antibody (M03), clone 3C9 now

Add to cart