Brand: | Abnova |
Reference: | H00005077-M06 |
Product name: | PAX3 monoclonal antibody (M06), clone 3A8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PAX3. |
Clone: | 3A8 |
Isotype: | IgG2b Kappa |
Gene id: | 5077 |
Gene name: | PAX3 |
Gene alias: | CDHS|HUP2|MGC120381|MGC120382|MGC120383|MGC120384|MGC134778|WS1 |
Gene description: | paired box 3 |
Genbank accession: | NM_181457 |
Immunogen: | PAX3 (NP_852122, 307 a.a. ~ 414 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSP |
Protein accession: | NP_852122 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |