PAX2 monoclonal antibody (M01), clone 3C7 View larger

PAX2 monoclonal antibody (M01), clone 3C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX2 monoclonal antibody (M01), clone 3C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PAX2 monoclonal antibody (M01), clone 3C7

Brand: Abnova
Reference: H00005076-M01
Product name: PAX2 monoclonal antibody (M01), clone 3C7
Product description: Mouse monoclonal antibody raised against a partial recombinant PAX2.
Clone: 3C7
Isotype: IgG2a Kappa
Gene id: 5076
Gene name: PAX2
Gene alias: -
Gene description: paired box 2
Genbank accession: NM_000278
Immunogen: PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Protein accession: NP_000269
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005076-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005076-M01-13-15-1.jpg
Application image note: Western Blot analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.

Lane 1: PAX2 transfected lysate(47.41 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Probing impaired neurogenesis in human brain organoids exposed to alcohol.Zhu Y, Wang L, Yin F, Yu Y, Wang Y, Shepard MJ, Zhuang Z, Qin J.
Integr Biol (Camb). 2017 Dec 11;9(12):968-978.

Reviews

Buy PAX2 monoclonal antibody (M01), clone 3C7 now

Add to cart