Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005076-M01 |
Product name: | PAX2 monoclonal antibody (M01), clone 3C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAX2. |
Clone: | 3C7 |
Isotype: | IgG2a Kappa |
Gene id: | 5076 |
Gene name: | PAX2 |
Gene alias: | - |
Gene description: | paired box 2 |
Genbank accession: | NM_000278 |
Immunogen: | PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP |
Protein accession: | NP_000269 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7. Lane 1: PAX2 transfected lysate(47.41 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Probing impaired neurogenesis in human brain organoids exposed to alcohol.Zhu Y, Wang L, Yin F, Yu Y, Wang Y, Shepard MJ, Zhuang Z, Qin J. Integr Biol (Camb). 2017 Dec 11;9(12):968-978. |