PARK2 monoclonal antibody (M01), clone 1H4 View larger

PARK2 monoclonal antibody (M01), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PARK2 monoclonal antibody (M01), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about PARK2 monoclonal antibody (M01), clone 1H4

Brand: Abnova
Reference: H00005071-M01
Product name: PARK2 monoclonal antibody (M01), clone 1H4
Product description: Mouse monoclonal antibody raised against a partial recombinant PARK2.
Clone: 1H4
Isotype: IgG3 Kappa
Gene id: 5071
Gene name: PARK2
Gene alias: AR-JP|LPRS2|PDJ|PRKN
Gene description: Parkinson disease (autosomal recessive, juvenile) 2, parkin
Genbank accession: BC022014
Immunogen: PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
Protein accession: AAH22014
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005071-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00005071-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Regional and cellular localisation of Parkin Co-Regulated Gene in developing and adult mouse brain.Brody KM, Taylor JM, Wilson GR, Delatycki MB, Lockhart PJ.
Brain Res. 2008 Mar 27;1201:177-86. Epub 2008 Jan 30.

Reviews

Buy PARK2 monoclonal antibody (M01), clone 1H4 now

Add to cart