Brand: | Abnova |
Reference: | H00005071-M01 |
Product name: | PARK2 monoclonal antibody (M01), clone 1H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PARK2. |
Clone: | 1H4 |
Isotype: | IgG3 Kappa |
Gene id: | 5071 |
Gene name: | PARK2 |
Gene alias: | AR-JP|LPRS2|PDJ|PRKN |
Gene description: | Parkinson disease (autosomal recessive, juvenile) 2, parkin |
Genbank accession: | BC022014 |
Immunogen: | PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK |
Protein accession: | AAH22014 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Regional and cellular localisation of Parkin Co-Regulated Gene in developing and adult mouse brain.Brody KM, Taylor JM, Wilson GR, Delatycki MB, Lockhart PJ. Brain Res. 2008 Mar 27;1201:177-86. Epub 2008 Jan 30. |