PAK3 monoclonal antibody (M08), clone 3A12 View larger

PAK3 monoclonal antibody (M08), clone 3A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAK3 monoclonal antibody (M08), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about PAK3 monoclonal antibody (M08), clone 3A12

Brand: Abnova
Reference: H00005063-M08
Product name: PAK3 monoclonal antibody (M08), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant PAK3.
Clone: 3A12
Isotype: IgG2a Kappa
Gene id: 5063
Gene name: PAK3
Gene alias: CDKN1A|MRX30|MRX47|OPHN3|PAK3beta|bPAK|hPAK3
Gene description: p21 protein (Cdc42/Rac)-activated kinase 3
Genbank accession: NM_002578
Immunogen: PAK3 (NP_002569, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
Protein accession: NP_002569
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005063-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00005063-M08-4-8-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: P21-Activated Kinase Inhibitors FRAX486 and IPA3: Inhibition of Prostate Stromal Cell Growth and Effects on Smooth Muscle Contraction in the Human Prostate.Wang Y, Gratzke C, Tamalunas A, Wiemer N, Ciotkowska A, Rutz B, Waidelich R, Strittmatter F, Liu C, Stief CG, Hennenberg M.
PLoS One. 2016 Apr 12;11(4):e0153312.

Reviews

Buy PAK3 monoclonal antibody (M08), clone 3A12 now

Add to cart