Brand: | Abnova |
Reference: | H00005063-M07 |
Product name: | PAK3 monoclonal antibody (M07), clone 1H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAK3. |
Clone: | 1H7 |
Isotype: | IgG2a Kappa |
Gene id: | 5063 |
Gene name: | PAK3 |
Gene alias: | CDKN1A|MRX30|MRX47|OPHN3|PAK3beta|bPAK|hPAK3 |
Gene description: | p21 protein (Cdc42/Rac)-activated kinase 3 |
Genbank accession: | NM_002578 |
Immunogen: | PAK3 (NP_002569, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE |
Protein accession: | NP_002569 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A 14-3-3γ dimer-based scaffold bridges CtBP1-S/BARS to PI(4)KIIIβ to regulate post-Golgi carrier formation.Valente C, Turacchio G, Mariggio S, Pagliuso A, Gaibisso R, Di Tullio G, Santoro M, Formiggini F, Spano S, Piccini D, Polishchuk RS, Colanzi A, Luini A, Corda D. Nat Cell Biol. 2012 Feb 26. doi: 10.1038/ncb2445. [Epub ahead of print] |