PAK3 monoclonal antibody (M07), clone 1H7 View larger

PAK3 monoclonal antibody (M07), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAK3 monoclonal antibody (M07), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about PAK3 monoclonal antibody (M07), clone 1H7

Brand: Abnova
Reference: H00005063-M07
Product name: PAK3 monoclonal antibody (M07), clone 1H7
Product description: Mouse monoclonal antibody raised against a partial recombinant PAK3.
Clone: 1H7
Isotype: IgG2a Kappa
Gene id: 5063
Gene name: PAK3
Gene alias: CDKN1A|MRX30|MRX47|OPHN3|PAK3beta|bPAK|hPAK3
Gene description: p21 protein (Cdc42/Rac)-activated kinase 3
Genbank accession: NM_002578
Immunogen: PAK3 (NP_002569, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
Protein accession: NP_002569
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005063-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00005063-M07-4-8-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A 14-3-3γ dimer-based scaffold bridges CtBP1-S/BARS to PI(4)KIIIβ to regulate post-Golgi carrier formation.Valente C, Turacchio G, Mariggio S, Pagliuso A, Gaibisso R, Di Tullio G, Santoro M, Formiggini F, Spano S, Piccini D, Polishchuk RS, Colanzi A, Luini A, Corda D.
Nat Cell Biol. 2012 Feb 26. doi: 10.1038/ncb2445. [Epub ahead of print]

Reviews

Buy PAK3 monoclonal antibody (M07), clone 1H7 now

Add to cart