PBP (Human) Recombinant Protein (P01) View larger

PBP (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PBP (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PBP (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00005037-P01
Product name: PBP (Human) Recombinant Protein (P01)
Product description: Human PBP full-length ORF ( AAH31102, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 5037
Gene name: PEBP1
Gene alias: HCNP|PBP|PEBP|RKIP
Gene description: phosphatidylethanolamine binding protein 1
Genbank accession: BC031102
Immunogen sequence/protein sequence: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Protein accession: AAH31102
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00005037-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Use of cancer-specific yeast-secreted in vivo biotinylated recombinant antibodies for serum biomarker discovery.Scholler N, Gross JA, Garvik B, Wells L, Liu Y, Loch CM, Ramirez AB, McIntosh MW, Lampe PD, Urban N.
J Transl Med. 2008 Jul 24;6:41.

Reviews

Buy PBP (Human) Recombinant Protein (P01) now

Add to cart