Brand: | Abnova |
Reference: | H00005028-A01 |
Product name: | P2RY1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant P2RY1. |
Gene id: | 5028 |
Gene name: | P2RY1 |
Gene alias: | P2Y1 |
Gene description: | purinergic receptor P2Y, G-protein coupled, 1 |
Genbank accession: | NM_002563 |
Immunogen: | P2RY1 (NP_002554, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY |
Protein accession: | NP_002554 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |