P2RX5 purified MaxPab mouse polyclonal antibody (B01P) View larger

P2RX5 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of P2RX5 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about P2RX5 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005026-B01P
Product name: P2RX5 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human P2RX5 protein.
Gene id: 5026
Gene name: P2RX5
Gene alias: MGC47755|P2X5|P2X5R
Gene description: purinergic receptor P2X, ligand-gated ion channel, 5
Genbank accession: NM_002561.2
Immunogen: P2RX5 (NP_002552.2, 1 a.a. ~ 422 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Protein accession: NP_002552.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005026-B01P-13-15-1.jpg
Application image note: Western Blot analysis of P2RX5 expression in transfected 293T cell line (H00005026-T02) by P2RX5 MaxPab polyclonal antibody.

Lane 1: P2RX5 transfected lysate(46.42 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy P2RX5 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart