Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of P2RX4 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr,Flow Cyt |
More info about P2RX4 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00005025-B01P |
| Product name: | P2RX4 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human P2RX4 protein. |
| Gene id: | 5025 |
| Gene name: | P2RX4 |
| Gene alias: | P2X4|P2X4R |
| Gene description: | purinergic receptor P2X, ligand-gated ion channel, 4 |
| Genbank accession: | NM_002560.2 |
| Immunogen: | P2RX4 (NP_002551.2, 1 a.a. ~ 388 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ |
| Protein accession: | NP_002551.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of P2RX4 expression in transfected 293T cell line (H00005025-T01) by P2RX4 MaxPab polyclonal antibody. Lane 1: P2RX4 transfected lysate(42.68 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr,Flow Cyt |
| Shipping condition: | Dry Ice |
| Publications: | Purinergic receptors expressed in human skeletal muscle fibres.Borno A, Ploug T, Bune LT, Rosenmeier JB, Thaning P Purinergic Signal. 2012 Jun;8(2):255-64. doi: 10.1007/s11302-011-9279-y. Epub 2011 Nov 4. |