Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr,Flow Cyt |
Brand: | Abnova |
Reference: | H00005025-B01P |
Product name: | P2RX4 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human P2RX4 protein. |
Gene id: | 5025 |
Gene name: | P2RX4 |
Gene alias: | P2X4|P2X4R |
Gene description: | purinergic receptor P2X, ligand-gated ion channel, 4 |
Genbank accession: | NM_002560.2 |
Immunogen: | P2RX4 (NP_002551.2, 1 a.a. ~ 388 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ |
Protein accession: | NP_002551.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of P2RX4 expression in transfected 293T cell line (H00005025-T01) by P2RX4 MaxPab polyclonal antibody. Lane 1: P2RX4 transfected lysate(42.68 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,Flow Cyt |
Shipping condition: | Dry Ice |
Publications: | Purinergic receptors expressed in human skeletal muscle fibres.Borno A, Ploug T, Bune LT, Rosenmeier JB, Thaning P Purinergic Signal. 2012 Jun;8(2):255-64. doi: 10.1007/s11302-011-9279-y. Epub 2011 Nov 4. |