OVOL1 MaxPab mouse polyclonal antibody (B01) View larger

OVOL1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OVOL1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about OVOL1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00005017-B01
Product name: OVOL1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human OVOL1 protein.
Gene id: 5017
Gene name: OVOL1
Gene alias: HOVO1
Gene description: ovo-like 1(Drosophila)
Genbank accession: BC059408
Immunogen: OVOL1 (AAH59408, 1 a.a. ~ 267 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPRAFLVKKPCVSTCKRNWSELPDEGRGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRAKMKVTLGDSPSGDLFTCRVCQRAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Protein accession: AAH59408
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005017-B01-13-15-1.jpg
Application image note: Western Blot analysis of OVOL1 expression in transfected 293T cell line (H00005017-T01) by OVOL1 MaxPab polyclonal antibody.

Lane 1: OVOL1 transfected lysate(29.48 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy OVOL1 MaxPab mouse polyclonal antibody (B01) now

Add to cart