OTX1 MaxPab rabbit polyclonal antibody (D01) View larger

OTX1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OTX1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIP

More info about OTX1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00005013-D01
Product name: OTX1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human OTX1 protein.
Gene id: 5013
Gene name: OTX1
Gene alias: FLJ38361|MGC15736
Gene description: orthodenticle homeobox 1
Genbank accession: NM_014562.2
Immunogen: OTX1 (NP_055377.1, 1 a.a. ~ 354 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL
Protein accession: NP_055377.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005013-D01-31-15-1.jpg
Application image note: Immunoprecipitation of OTX1 transfected lysate using anti-OTX1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OTX1 monoclonal antibody (M01), clone 1F2 (H00005013-M01).
Applications: IP
Shipping condition: Dry Ice

Reviews

Buy OTX1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart