TNFRSF11B purified MaxPab rabbit polyclonal antibody (D01P) View larger

TNFRSF11B purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF11B purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about TNFRSF11B purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004982-D01P
Product name: TNFRSF11B purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TNFRSF11B protein.
Gene id: 4982
Gene name: TNFRSF11B
Gene alias: MGC29565|OCIF|OPG|TR1
Gene description: tumor necrosis factor receptor superfamily, member 11b
Genbank accession: BC030155
Immunogen: TNFRSF11B (AAH30155.1, 1 a.a. ~ 401 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Protein accession: AAH30155.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004982-D01P-13-15-1.jpg
Application image note: Western Blot analysis of TNFRSF11B expression in transfected 293T cell line (H00004982-T01) by TNFRSF11B MaxPab polyclonal antibody.

Lane 1: TNFRSF11B transfected lysate(46.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNFRSF11B purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart