NPY5R purified MaxPab mouse polyclonal antibody (B01P) View larger

NPY5R purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPY5R purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr,Flow Cyt

More info about NPY5R purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004889-B01P
Product name: NPY5R purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NPY5R protein.
Gene id: 4889
Gene name: NPY5R
Gene alias: NPYR5
Gene description: neuropeptide Y receptor Y5
Genbank accession: NM_006174
Immunogen: NPY5R (NP_006165.1, 1 a.a. ~ 445 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM
Protein accession: NP_006165.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004889-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NPY5R expression in transfected 293T cell line (H00004889-T01) by NPY5R MaxPab polyclonal antibody.

Lane 1: NPY5R transfected lysate(48.95 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,Flow Cyt
Shipping condition: Dry Ice

Reviews

Buy NPY5R purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart