NPY1R purified MaxPab mouse polyclonal antibody (B01P) View larger

NPY1R purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPY1R purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NPY1R purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004886-B01P
Product name: NPY1R purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NPY1R protein.
Gene id: 4886
Gene name: NPY1R
Gene alias: NPYR
Gene description: neuropeptide Y receptor Y1
Genbank accession: NM_000909
Immunogen: NPY1R (AAH71720.1, 1 a.a. ~ 384 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Protein accession: AAH71720.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004886-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NPY1R expression in transfected 293T cell line (H00004886-T01) by NPY1R MaxPab polyclonal antibody.

Lane 1: NPY1R transfected lysate(44.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NPY1R purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart