NPHP1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NPHP1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPHP1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about NPHP1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004867-D01P
Product name: NPHP1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NPHP1 protein.
Gene id: 4867
Gene name: NPHP1
Gene alias: FLJ97602|JBTS4|NPH1|SLSN1
Gene description: nephronophthisis 1 (juvenile)
Genbank accession: NM_207181.1
Immunogen: NPHP1 (NP_997064.1, 1 a.a. ~ 121 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEYASFLPFFFLF
Protein accession: NP_997064.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004867-D01P-2-D9-1.jpg
Application image note: NPHP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPHP1 expression in mouse testis.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NPHP1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart