NPHP1 MaxPab mouse polyclonal antibody (B01) View larger

NPHP1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPHP1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NPHP1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004867-B01
Product name: NPHP1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NPHP1 protein.
Gene id: 4867
Gene name: NPHP1
Gene alias: FLJ97602|JBTS4|NPH1|SLSN1
Gene description: nephronophthisis 1 (juvenile)
Genbank accession: NM_207181.1
Immunogen: NPHP1 (NP_997064.1, 1 a.a. ~ 121 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEYASFLPFFFLF
Protein accession: NP_997064.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004867-B01-13-15-1.jpg
Application image note: Western Blot analysis of NPHP1 expression in transfected 293T cell line (H00004867-T01) by NPHP1 MaxPab polyclonal antibody.

Lane 1: NPHP1 transfected lysate(13.31 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NPHP1 MaxPab mouse polyclonal antibody (B01) now

Add to cart