NP polyclonal antibody (A01) View larger

NP polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NP polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NP polyclonal antibody (A01)

Brand: Abnova
Reference: H00004860-A01
Product name: NP polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NP.
Gene id: 4860
Gene name: NP
Gene alias: FLJ94043|FLJ97288|FLJ97312|MGC117396|MGC125915|MGC125916|PNP|PRO1837|PUNP
Gene description: nucleoside phosphorylase
Genbank accession: NM_000270
Immunogen: NP (NP_000261, 174 a.a. ~ 283 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIP
Protein accession: NP_000261
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004860-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004860-A01-1-6-1.jpg
Application image note: NP polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of NP expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NP polyclonal antibody (A01) now

Add to cart