NOV purified MaxPab mouse polyclonal antibody (B01P) View larger

NOV purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOV purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NOV purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004856-B01P
Product name: NOV purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NOV protein.
Gene id: 4856
Gene name: NOV
Gene alias: CCN3|IGFBP9
Gene description: nephroblastoma overexpressed gene
Genbank accession: BC015028.1
Immunogen: NOV (AAH15028.1, 1 a.a. ~ 357 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Protein accession: AAH15028.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004856-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NOV expression in transfected 293T cell line (H00004856-T01) by NOV MaxPab polyclonal antibody.

Lane 1: NOV transfected lysate(39.27 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NOV purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart