Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NOS3 monoclonal antibody (M04), clone 1D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about NOS3 monoclonal antibody (M04), clone 1D12
| Brand: | Abnova |
| Reference: | H00004846-M04 |
| Product name: | NOS3 monoclonal antibody (M04), clone 1D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NOS3. |
| Clone: | 1D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4846 |
| Gene name: | NOS3 |
| Gene alias: | ECNOS|eNOS |
| Gene description: | nitric oxide synthase 3 (endothelial cell) |
| Genbank accession: | BC063294 |
| Immunogen: | NOS3 (AAH63294.1, 61 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT |
| Protein accession: | AAH63294.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between AKT1 and NOS3. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-NOS3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |