Brand: | Abnova |
Reference: | H00004843-M11 |
Product name: | NOS2 monoclonal antibody (M11), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NOS2. |
Clone: | 2G4 |
Isotype: | IgG1 Kappa |
Gene id: | 4843 |
Gene name: | NOS2 |
Gene alias: | HEP-NOS|INOS|NOS|NOS2A |
Gene description: | nitric oxide synthase 2, inducible |
Genbank accession: | NM_000625 |
Immunogen: | NOS2 (NP_000616, 685 a.a. ~ 794 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG |
Protein accession: | NP_000616 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NOS2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |