NOS2 monoclonal antibody (M11), clone 2G4 View larger

NOS2 monoclonal antibody (M11), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOS2 monoclonal antibody (M11), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NOS2 monoclonal antibody (M11), clone 2G4

Brand: Abnova
Reference: H00004843-M11
Product name: NOS2 monoclonal antibody (M11), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant NOS2.
Clone: 2G4
Isotype: IgG1 Kappa
Gene id: 4843
Gene name: NOS2
Gene alias: HEP-NOS|INOS|NOS|NOS2A
Gene description: nitric oxide synthase 2, inducible
Genbank accession: NM_000625
Immunogen: NOS2 (NP_000616, 685 a.a. ~ 794 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
Protein accession: NP_000616
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004843-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004843-M11-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NOS2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NOS2 monoclonal antibody (M11), clone 2G4 now

Add to cart