Brand: | Abnova |
Reference: | H00004838-M05 |
Product name: | NODAL monoclonal antibody (M05), clone 5A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NODAL. |
Clone: | 5A3 |
Isotype: | IgG2a Kappa |
Gene id: | 4838 |
Gene name: | NODAL |
Gene alias: | MGC138230 |
Gene description: | nodal homolog (mouse) |
Genbank accession: | NM_018055 |
Immunogen: | NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC |
Protein accession: | NP_060525 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | NODAL monoclonal antibody (M05), clone 5A3 Western Blot analysis of NODAL expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |