Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NODAL monoclonal antibody (M03), clone 5C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about NODAL monoclonal antibody (M03), clone 5C3
| Brand: | Abnova |
| Reference: | H00004838-M03 |
| Product name: | NODAL monoclonal antibody (M03), clone 5C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NODAL. |
| Clone: | 5C3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4838 |
| Gene name: | NODAL |
| Gene alias: | MGC138230 |
| Gene description: | nodal homolog (mouse) |
| Genbank accession: | NM_018055 |
| Immunogen: | NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC |
| Protein accession: | NP_060525 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Reactivation of embryonic nodal signaling is associated with tumor progression and promotes the growth of prostate cancer cells.Lawrence MG, Margaryan NV, Loessner D, Collins A, Kerr KM, Turner M, Seftor EA, Stephens CR, Lai J, Postovit LM, Clements JA, Hendrix MJ; APC BioResource. Prostate. 2011 Jan 12. [Epub ahead of print] |