Brand: | Abnova |
Reference: | H00004837-A01 |
Product name: | NNMT polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant NNMT. |
Gene id: | 4837 |
Gene name: | NNMT |
Gene alias: | - |
Gene description: | nicotinamide N-methyltransferase |
Genbank accession: | BC000234 |
Immunogen: | NNMT (AAH00234, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
Protein accession: | AAH00234 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (55.15 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NNMT polyclonal antibody (A01), Lot # CIL0051213QCS1 Western Blot analysis of NNMT expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |