NNMT polyclonal antibody (A01) View larger

NNMT polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NNMT polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NNMT polyclonal antibody (A01)

Brand: Abnova
Reference: H00004837-A01
Product name: NNMT polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant NNMT.
Gene id: 4837
Gene name: NNMT
Gene alias: -
Gene description: nicotinamide N-methyltransferase
Genbank accession: BC000234
Immunogen: NNMT (AAH00234, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Protein accession: AAH00234
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004837-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.15 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004837-A01-1-4-1.jpg
Application image note: NNMT polyclonal antibody (A01), Lot # CIL0051213QCS1 Western Blot analysis of NNMT expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NNMT polyclonal antibody (A01) now

Add to cart