NME4 purified MaxPab mouse polyclonal antibody (B01P) View larger

NME4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NME4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NME4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004833-B01P
Product name: NME4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NME4 protein.
Gene id: 4833
Gene name: NME4
Gene alias: NDPK-D|NM23H4|nm23-H4
Gene description: non-metastatic cells 4, protein expressed in
Genbank accession: NM_005009.2
Immunogen: NME4 (NP_005000.1, 1 a.a. ~ 187 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Protein accession: NP_005000.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004833-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NME4 expression in transfected 293T cell line (H00004833-T01) by NME4 MaxPab polyclonal antibody.

Lane 1: NME4 transfected lysate(20.57 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NME4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart