Brand: | Abnova |
Reference: | H00004831-M06 |
Product name: | NME2 monoclonal antibody (M06), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NME2. |
Clone: | 1D3 |
Isotype: | IgG3 Kappa |
Gene id: | 4831 |
Gene name: | NME2 |
Gene alias: | MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf |
Gene description: | non-metastatic cells 2, protein (NM23B) expressed in |
Genbank accession: | NM_002512 |
Immunogen: | NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Protein accession: | NP_002503 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004831-M06-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004831-M06-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00004831-M06-1-1-1.jpg](http://www.abnova.com/application_image/H00004831-M06-1-1-1.jpg) |
Application image note: | NME2 monoclonal antibody (M06), clone 1D3 Western Blot analysis of NME2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Early Insights into the Function of KIAA1199, a Markedly Overexpressed Protein in Human Colorectal Tumors.Tiwari A, Schneider M, Fiorino A, Haider R, Okoniewski MJ, Roschitzki B, Uzozie A, Menigatti M, Jiricny J, Marra G. PLoS One. 2013 Jul 23;8(7):e69473 |