Brand: | Abnova |
Reference: | H00004830-A02 |
Product name: | NME1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NME1. |
Gene id: | 4830 |
Gene name: | NME1 |
Gene alias: | AWD|GAAD|NB|NBS|NDPK-A|NDPKA|NM23|NM23-H1 |
Gene description: | non-metastatic cells 1, protein (NM23A) expressed in |
Genbank accession: | NM_000269 |
Immunogen: | NME1 (NP_000260, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Protein accession: | NP_000260 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |