NKX3-1 monoclonal antibody (M03), clone 3C1 View larger

NKX3-1 monoclonal antibody (M03), clone 3C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NKX3-1 monoclonal antibody (M03), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NKX3-1 monoclonal antibody (M03), clone 3C1

Brand: Abnova
Reference: H00004824-M03
Product name: NKX3-1 monoclonal antibody (M03), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant NKX3-1.
Clone: 3C1
Isotype: IgG2b Kappa
Gene id: 4824
Gene name: NKX3-1
Gene alias: BAPX2|NKX3|NKX3.1|NKX3A
Gene description: NK3 homeobox 1
Genbank accession: NM_006167
Immunogen: NKX3-1 (NP_006158, 100 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
Protein accession: NP_006158
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004824-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004824-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NKX3-1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NKX3-1 monoclonal antibody (M03), clone 3C1 now

Add to cart