Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NFE2L2 monoclonal antibody (M03), clone 1B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about NFE2L2 monoclonal antibody (M03), clone 1B8
| Brand: | Abnova |
| Reference: | H00004780-M03 |
| Product name: | NFE2L2 monoclonal antibody (M03), clone 1B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NFE2L2. |
| Clone: | 1B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4780 |
| Gene name: | NFE2L2 |
| Gene alias: | NRF2 |
| Gene description: | nuclear factor (erythroid-derived 2)-like 2 |
| Genbank accession: | BC011558 |
| Immunogen: | NFE2L2 (AAH11558, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA |
| Protein accession: | AAH11558 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NFE2L2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Examining the endogenous antioxidant response through immunofluorescent analysis of Nrf2 in tissue.Lindl KA, Jordan-Sciutto KL. Methods Mol Biol. 2008;477:229-43. |